PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000436G0570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HSF
Protein Properties Length: 276aa    MW: 30176.5 Da    PI: 6.9293
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000436G0570genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.41.2e-242988261
                     HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
     HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
                     Fl+k+y++++d+ +++++sw e+ ++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y 
  PH01000436G0570 29 FLTKTYQLVDDPCTDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYR 88
                     9**********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.6E-262288IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004158.6E-2625186IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467852.04E-222888IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004476.0E-212988IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.2E-142952IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.2E-146779IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.2E-148092IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MAFLVERCGE MVVSMESSAH GGKPVPAPFL TKTYQLVDDP CTDHIVSWGE DDTTFVVWRP  60
PEFARDLLPN YFKHNNFSSF VRQLNTYRTG GSSPTSYSGR EPSTSSPRST GGSHRRRHHH  120
HLNPFSPPPP PPTHPVYHFQ EEPATTHGVS GGNDGGGGGD FLAALSEDNR QLRRRNSLLL  180
SELAHMKKLY NDIVYFLQNH VAPVTSPSST APQLPGAVVA SSCRLLELDT DSPPQRSAAA  240
VDDDTVKLFG VALQGTKKKR AHREEGDDHD KGSEV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B1e-159871087Heat shock factor protein 1
5d5v_B1e-159871087Heat shock factor protein 1
5d5v_D1e-159871087Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1013480.0FP101348.1 Phyllostachys edulis cDNA clone: bphyst036a08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958473.11e-114PREDICTED: heat stress transcription factor B-4b-like
SwissprotQ7XHZ01e-103HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBLK4A2Z11e-114K4A2Z1_SETIT; Uncharacterized protein
STRINGSi033243m1e-114(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46264.18e-41heat shock transcription factor B4